Introduction to Evolution

Introduction to Evolution: Evidence and Mechanisms

The Centrality of Evolution in Biology

  • Theodosius Dobzhansky's Quote: "Nothing in biology makes sense except in the light of evolution."

    • This highlights evolution as the unifying principle that explains the diversity and unity of life.

Evidence for Evolution

  • 1) Universally Shared Features

    • DNA Replication: All known life forms utilize DNA as their genetic material and replicate it through a highly conserved process.

      • The process involves an original DNA template, which is unwound by helicase at the replication fork.

      • DNA polymerase adds free nucleotides (Adenine, Thymine, Cytosine, Guanine) to synthesize new leading and lagging strands.

      • (A)denine pairs with (T)hymine, and (C)ytosine pairs with (G)uanine, forming the double helix with a phosphate backbone.

    • Cell Cycle: The fundamental process of cell division is conserved across eukaryotes.

      • Interphase: A period of growth and DNA replication.

        • G1\text{1} Phase: Cell grows and performs normal functions.

        • S Phase: DNA replication occurs (DNA synthesis).

        • G2\text{2} Phase: Cell prepares for mitosis.

      • M Phase (Cell Division):

        • Prophase: Chromosomes condense and the spindle forms.

        • Metaphase: Chromosomes align at the cell equator.

        • Anaphase: Sister chromatids separate and move to opposite poles.

        • Telophase: Chromosomes de-condense, nuclear envelopes reform.

      • Cytokinesis: Cytoplasm divides, forming two daughter cells.

      • G0\text{0} Phase (Resting Phase): Cells perform specialized functions without dividing.

    • "Frozen Accident" of the Genetic Code: The shared biochemistry of life, particularly the genetic code, is largely arbitrary.

      • Any code that maps the 64\text{64} possible triplet codons onto the 20\text{20} amino acids could work and could be implemented just as easily by an appropriate set of transfer RNAs.

      • The universality of this arbitrary code suggests a single origin that became "frozen" or fixed early in life's history.

  • 2) Hierarchical Classification

    • Organisms are classified into a nested hierarchy of groups within groups (e.g., Species within Genera, Genera within Families, etc.).

    • This arrangement is explained by "descent with modification", reflecting shared ancestry.

    • Taxonomic Ranks (from most inclusive to least inclusive):

      • Kingdom: Animals (organisms able to move on their own).

      • Phylum: Chordates (animals with a backbone).

      • Class: Mammals (chordates with fur or hair and milk glands).

      • Order: Primates (mammals with collar bones and grasping fingers).

      • Family: Hominids (primates with relatively flat faces and three-dimensional vision).

      • Genus: Homo (hominids with upright posture and large brains).

      • Species: Homo sapiens (member of the genus Homo with a high forehead and thin skull bones).

    • Homology: Biological similarity due to common ancestry.

      • Example: Vertebrate Forelimbs: Despite different functions, the skeletal structure of forelimbs in humans, cats, whales, and bats shows a conserved pattern (single bone Humerus, two bones Radius and Ulna, followed by Carpals, Metacarpals, and Phalanges).

    • Embryonic Similarity: Early embryonic stages of diverse organisms often exhibit remarkable similarities, which diverge as development proceeds.

      • Arthropod Examples: Early embryos of Insecta, Arachnida, and Myriapoda share common developmental patterns.

      • Vertebrate Examples: Early tailbud embryos of lamprey, dogfish, gar, salmon, lungfish, axolotl, hellbender, snake, chicken, possum, cat, bat, and human show striking resemblances, which become distinct in intermediate and late stages.

    • Molecular Homology (Homeobox Genes):

      • Homeobox (Hox) genes are a group of related genes involved in the developmental patterning of the body axis (anterior-posterior).

      • They dictate the identity of body segments (e.g., Head, Thorax, Abdomen).

      • Specific genes (e.g., lab, pb, Dfd, Scr, Antp, Ubx, abd-A, Abd-B in Drosophila; Hox1\text{1} to Hox13\text{13} in humans) are homologous across vast evolutionary distances.

      • The most recent common ancestor of a fly and a human existed approximately 550-600\text{550-600} Million years ago (Mya), yet these genes and their organizational clusters are conserved.

    • Analogy: The result of convergent evolution, where similar traits evolve independently in different lineages due to similar environmental pressures, not common ancestry.

  • 3) Geographic Distribution

    • Principle: Geographic proximity, not ecological similarity, is the strongest predictor of relatedness.

    • Example 2: Wallace's Line: This biogeographical boundary separates the Indomalayan and Australasian Realms.

      • It marks a deep-water channel that maintained a barrier to species dispersal even during periods of lower sea levels when landmasses like Sunda, Wallacea, and Sahul were larger.

      • Consequently, organisms on either side of the line, despite similar climates (e.g., tropical rainforests and savannas), have vastly different evolutionary histories and fauna (e.g., placental mammals vs. marsupials).

  • 4) Direct Observation of Evolution

    • Artificial Selection: Humans selectively breed organisms for desired traits, rapidly driving evolutionary change.

    • Natural Selection in Action (HIV Resistance to Ritonavir):

      • Step 1: Treatment with the antiviral drug ritonavir begins.

      • Step 2: The viral load of drug-sensitive HIV falls rapidly as these viruses are suppressed or killed.

      • Step 3: However, drug-resistant HIV strains (e.g., exhibiting mutations in the HIV protease enzyme: PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYEQVLIEICG KKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF) continue to grow despite the presence of the treatment. Over time, the growth of these resistant viruses can cause the viral load to rise again in the host.

    • Polyploidy: A mechanism of rapid speciation, particularly in plants.

      • Process: A hybrid (F1\text{1}) formed from Species 1 (with X chromosomes) and Species 2 (with Y chromosomes) may undergo genome duplication, resulting in a new species with 2X2X or 2(X+Y)2(X+Y) chromosomes.

      • Outcome: This new polyploid species cannot successfully interbreed with either of the parental species, thus establishing reproductive isolation and creating a new species almost instantly.

  • 5) Fossil Record

    • Provides a historical sequence of life, demonstrating continuous evolutionary change over vast periods.

    • Geological Time Scale: Groups that have diverged more recently should appear later in the fossil record.

      • Archean Eon: Earth forms ext4.6ext{4.6} billion years ago.

      • Proterozoic Eon: ext2.5ext{2.5} billion years ago.

      • Paleozoic Era:

      • Mesozoic Era:

      • Cenozoic Era:

  • 6) Ancient DNA (aDNA)

    • Genetic material recovered from ancient remains (fossils, bones, mummified tissues) provides direct molecular evidence of past evolutionary events.

    • Example: Human Ancestry: aDNA studies have revealed complex admixture events between modern humans, Neanderthals, and Denisovans.

      • Two distinct waves of Denisovan admixture have been detected in East Asian genomes.

      • This genetic exchange likely contributed to adaptations, such as the ability to thrive at high altitudes.